Рок-н-ролл - это не просто бар, это место, где душа находит свой дом. Здесь можно быть самим собой, тебя не осудят, не скажут, что ты сошел с ума.

2.50 Rating by CuteStat

rocknrollbar.ru is 1 decade 3 years old. It is a domain having ru extension. It has a global traffic rank of #3860243 in the world. This website is estimated worth of $ 240.00 and have a daily income of around $ 1.00. As no active threats were reported recently by users, rocknrollbar.ru is SAFE to browse.

PageSpeed Score
0
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 218
Daily Pageviews: 436

Estimated Valuation

Income Per Day: $ 1.00
Estimated Worth: $ 240.00

Search Engine Indexes

Google Indexed Pages: 46
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 36,600
Bing Backlinks: 223

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 3,860,243
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

81.177.140.107

Hosted Country:

Russia RU

Location Latitude:

55.7527

Location Longitude:

37.6172

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: 4
H3 Headings: 3 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 47
Google Adsense: Not Applicable Google Analytics: UA-16800196-3

Websites Hosted on Same IP (i.e. 81.177.140.107)

Сайт в разработке

- virus-video.ru
Not Applicable $ 8.95

Hider - Появляющаяся кнопка 'Купить'

- hidelinks.ru

Hide Links - Прятатель кнопки оформления заказа, которая появляется на определенной минуте Вашего продающего видео

Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Thu, 12 Dec 2019 22:29:43 GMT
Server: Apache/2.4.6 (CentOS) OpenSSL/1.0.2k-fips PHP/5.6.30
X-Powered-By: PHP/5.6.30
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Domain Information

Domain Registrar: RU-CENTER-RU
Registration Date: Oct 14, 2010, 3:45 PM 1 decade 3 years 6 months ago
Expiration Date: Oct 14, 2020, 4:45 PM 3 years 6 months 4 weeks ago
Domain Status:
registered
delegated
verified

Domain Nameserver Information

Host IP Address Country
ns1.jino.ru 217.107.34.200 Russia Russia
ns2.jino.ru 195.161.62.86 Russia Russia
ns3.jino.ru 217.107.219.170 Russia Russia
ns4.jino.ru 81.177.139.205 Russia Russia

DNS Record Analysis

Host Type TTL Extra
rocknrollbar.ru A 10799 IP: 81.177.140.107
rocknrollbar.ru NS 10800 Target: ns2.jino.ru
rocknrollbar.ru NS 10800 Target: ns3.jino.ru
rocknrollbar.ru NS 10800 Target: ns4.jino.ru
rocknrollbar.ru NS 10800 Target: ns1.jino.ru
rocknrollbar.ru SOA 10800 MNAME: ns1.jino.ru
RNAME: hostmaster.jino.ru
Serial: 2018061401
Refresh: 16384
Retry: 2048
Expire: 1048576
Minimum TTL: 25600

Similarly Ranked Websites

Business and IT Consulting Services for Small Businesses

- daemon.co.in

Daemon software delivers value through our Business and IT consulting Services that help clients improve performance & reduce costs by harnessing the power of the digital economy.

3,860,244 $ 240.00

ATS - Leading Electrical Solutions Provider in Cambodia | Home

- ats.com.kh

ATS is a specialist of energy and electrical distribution and automation systems. We supply, design and manufacture solutions meeting specific clients and projects thanks to our manufacturing facility and our multi-technologies / multi-brands approach.

3,860,249 $ 240.00

ClickFunnels™ - Marketing Funnels Made Easy

- physique-zero.com

ClickFunnels Gives You EVERYTHING You Need To Market, Sell, and Deliver Your Products and Services Online! Without having to hire or rely on a tech team!

3,860,251 $ 240.00

ELEKTRİKLİ BİSİKLETLER BEYİNLER AKÜLER TANITIMLAR ELEKTRİKLİ BİSİKLET

- elektriklibisiklet.org

elektrikli bisiklet şarj,elektrikli bisiklet,elektrikli bisiklet beyin,elektrikli bisiklet modifiye,led far,power led far,elektrikli bisiklet aküsü,elektrikli scoter,elektrikli bisiklet gaz kolu,elektrikli bisiklet aküsü,12 volt 20 amper akü,jel akü,

3,860,256 $ 240.00

404 Not Found

- watchintenselyswiftthefile.vip
3,860,262 $ 240.00

Full WHOIS Lookup

% By submitting a query to RIPN's Whois Service
% you agree to abide by the following terms of use:
% http://www.ripn.net/about/servpol.html#3.2 (in Russian)
% http://www.ripn.net/about/en/servpol.html#3.2 (in English).

domain: ROCKNROLLBAR.RU
nserver: ns1.jino.ru.
nserver: ns2.jino.ru.
nserver: ns3.jino.ru.
nserver: ns4.jino.ru.
state: REGISTERED, DELEGATED, VERIFIED
person: Private Person
registrar: RU-CENTER-RU
admin-contact: https://www.nic.ru/whois
created: 2010-10-14T10:00:56Z
paid-till: 2020-10-14T11:00:56Z
free-date: 2020-11-14
source: TCI

Last updated on 2019-12-12T22:26:33Z